ZNF735 Rabbit Polyclonal Antibody TA330837 from OriGene Technologies | Biocompare.com

Supplier Images

ZNF735 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ZNF735 Rabbit Polyclonal Antibody

OriGene Technologies' ZNF735 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The ZNF735 Rabbit Polyclonal Antibody was generated using ZNF735 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-ZNF735 Antibody

Product Specs
ItemZNF735 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA330837
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetZNF735
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-ZNF735 antibody is: synthetic peptide directed towards the middle region of Human ZNF735. Synthetic peptide located within the following region: NLFSLGMTVSKPDLIACLEQNKEPQNIKRNEMAAKHPVTCSHFNQDLQPE
NCBI Full Gene Namezinc finger protein 735
NCBI Gene AliasesZNF735P
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!